Mozilla Support में खोजें

Avoid support scams. We will never ask you to call or text a phone number or share personal information. Please report suspicious activity using the “Report Abuse” option.

Learn More

Sending Emails from Thunderbird to Gmail

  • 1 प्रत्युत्तर दें
  • 0 यह समस्या है
  • 1 view
  • के द्वारा अंतिम प्रतियुतर christ1

more options

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you.

Here is an example of the error message:

The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]

  ----- The following addresses had permanent fatal errors -----

<[email protected]>

   (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the)
  ----- Transcript of session follows -----

... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable


Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400

Final-Recipient: RFC822; [email protected] Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400


X-POP-User: [email protected] Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of [email protected] has no SPF policy when checking 108.204.192.198) [email protected]; dmarc=none X-Envelope-From: [email protected] Return-Path: <[email protected]> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <[email protected]>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative;

boundary="------------2AMDNET0HgJUeo3qv9elOmlc"

Message-ID: <[email protected]> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101

Thunderbird/102.12.0

Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: [email protected] From: Matt McKeegan <[email protected]> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: [email protected] X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you. Here is an example of the error message: The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198] ----- The following addresses had permanent fatal errors ----- <[email protected]> (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the) ----- Transcript of session follows ----- ... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400 Final-Recipient: RFC822; [email protected] Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400 X-POP-User: [email protected] Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of [email protected] has no SPF policy when checking 108.204.192.198) [email protected]; dmarc=none X-Envelope-From: [email protected] Return-Path: <[email protected]> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <[email protected]>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative; boundary="------------2AMDNET0HgJUeo3qv9elOmlc" Message-ID: <[email protected]> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.12.0 Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: [email protected] From: Matt McKeegan <[email protected]> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: [email protected] X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

All Replies (1)

more options

Your email provider neither supports SPF nor DKIM. Talk to your email provider, and pass on the link with the instructions Google provided in the error message.