Sending Emails from Thunderbird to Gmail
Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you.
Here is an example of the error message:
The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]
----- The following addresses had permanent fatal errors -----
(reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the)
----- Transcript of session follows -----
... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable
Reporting-MTA: dns; mail290c9.megamailservers.com
Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net
Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400
Final-Recipient: RFC822; [email protected] Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400
X-POP-User: [email protected]
Feedback-ID:matt@mckeeganas
Authentication-Results: MTA-69.156.243.30;
dkim=none;
spf=none (MTA-69.156.243.30: domain of [email protected] has no SPF policy when checking 108.204.192.198) [email protected];
dmarc=none
X-Envelope-From: [email protected]
Return-Path: <[email protected]>
Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198])
by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129
for <[email protected]>; Thu, 6 Jul 2023 11:09:51 -0400
Content-Type: multipart/alternative;
boundary="------------2AMDNET0HgJUeo3qv9elOmlc"
Message-ID: <[email protected]> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101
Thunderbird/102.12.0
Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: [email protected] From: Matt McKeegan <[email protected]> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: [email protected] X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US
All Replies (1)
Your email provider neither supports SPF nor DKIM. Talk to your email provider, and pass on the link with the instructions Google provided in the error message.